DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and prss60.1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:270 Identity:109/270 - (40%)
Similarity:147/270 - (54%) Gaps:28/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPE---GLLPQLDGRIVGGSATTISSFPWQISLQRS--GSHSCGGSIYSANI 65
            :.|:.::|..|.....   ||.| |:.|||||......|:|||:||...  |.|.||||:.::..
Zfish     7 VSLALLLCVQGSHSQLNVCGLAP-LNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEW 70

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSGGVVA-----KVSSFKNHEGYNANTMVNDIAVIRLSSS 125
            ::||||||..::.|.|.|..|.|  :..||..     .||....|..||..|..||||::.|||:
Zfish    71 VLTAAHCLPRITTSSLLVFLGKT--TQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSA 133

  Fly   126 LSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSG-SSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            ::||:.|:.:.||..|..  ||.|:.::|||....| :...|..||...:.:|...|| ::..|.
Zfish   134 VTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-NALLGS 197

  Fly   188 GSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLV----GVVSWGYGCAYSNYPGVYADVAVLR 246
            || :.|.||||.  ..|:|.||||||||:||...||    |:.|||||||....||||..|:..:
Zfish   198 GS-VTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQ 261

  Fly   247 SWVVSTANSI 256
            ||:    |||
Zfish   262 SWI----NSI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 98/234 (42%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 98/234 (42%)
Tryp_SPc 34..267 CDD:238113 99/240 (41%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.