DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and f7

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:253 Identity:80/253 - (31%)
Similarity:117/253 - (46%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEGLLPQLD-----GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSAS 79
            |.|.:|.|.     .|||||........|||..|..:....|||::.:.|.::||||||:.:..:
 Frog   196 PCGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGTLIAPNWVITAAHCLKPLPEN 260

  Fly    80 VLQV-----RAGSTYWSSGGVVAKVSSFKNHEGY--NANTMVNDIAVIRLSSSLSFSSSIKAISL 137
            .|.|     |.|:...:.  ..:|||....||.|  :.....||||:::|::.::::..:..:.|
 Frog   261 KLTVVLGEHRIGTPEGTE--QESKVSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDYVVPLCL 323

  Fly   138 -----ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMIC 197
                 |.....:...:.||||| :...|.:.|..||.|.:..|....|...|.   ..|...|.|
 Frog   324 PEKQFAVQELLSIRYSTVSGWG-RLLESGATPELLQRVQLPRVKTQDCIRQTQ---MNISQNMFC 384

  Fly   198 AAAS--GKDACQGDSGGP----LVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |..:  .||:|:||||||    ..:...|.|:||||.|||.....|||..|:....|:
 Frog   385 AGYTDGSKDSCKGDSGGPHATQYKNTHFLTGIVSWGLGCAKKEKYGVYTRVSRYTEWI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/236 (32%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209
Tryp_SPc 212..445 CDD:238113 75/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.