DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss8

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:273 Identity:97/273 - (35%)
Similarity:134/273 - (49%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALGGTVPEGLLPQLDG-----------RIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            |.:..:..|.|.:..|:  :.||           ||.||.:.....:|||:|:...|:|.||||:
Mouse    12 LEAVTILLLLGLLQSGI--RADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSL 74

  Fly    61 YSANIIVTAAHCL-QSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIR 121
            .|...:|:||||. :..|....:|:.|:   ..:|:..||..|:....|..|.......|||:||
Mouse    75 VSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIR 139

  Fly   122 LSSSLSFSSSIKAISLATYNPA--NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASS 183
            |||.::||..|:.|.|...|.:  ||....|:||| ...|.|...|..||.:.|.::|:..| |.
Mouse   140 LSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETC-SC 203

  Fly   184 TYGYGS------QIRNTMICA--AASGKDACQGDSGGPL---VSG-GVLVGVVSWGYGCAYSNYP 236
            .|...:      .|:..|:||  ...|||||||||||||   :.| ..|.|:||||..|...|.|
Mouse   204 LYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRP 268

  Fly   237 GVYADVAVLRSWV 249
            |||...:...||:
Mouse   269 GVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/237 (38%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 90/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.