DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss52

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_082801.2 Gene:Prss52 / 73382 MGIID:1920632 Length:321 Species:Mus musculus


Alignment Length:278 Identity:92/278 - (33%)
Similarity:133/278 - (47%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALG---GTVPEGLLPQL-------DGR----IVGGSATTISSFPWQISLQRS 51
            :|.:|:||.....:|.   |........||       :|:    ||||....|..|||.:.:...
Mouse    12 LLPLVLLLFGACSSLAWVCGRRMSSRSQQLNNASAIVEGKPASAIVGGKPANILEFPWHVGIMNH 76

  Fly    52 GSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGV-VAKVSSFKNHEGYNANTMVN 115
            |||.|||||.:...:::|:||...::.|.|::..|:...|:.|: ..||.....|..::...:.|
Mouse    77 GSHLCGGSILNEWWVLSASHCFDQLNNSKLEIIHGTEDLSTKGIKYQKVDKLFLHPKFDDWLLDN 141

  Fly   116 DIAVIRLSSSLSFSSSIKAISLATYNPAN---GASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVS 176
            |||::.|.|.|:.  |:..|.:.|...::   ..:..|:||| |.:|.....|:.||.|.|::..
Mouse   142 DIALLLLKSPLNL--SVNRIPICTSEISDIQAWRNCWVTGWGITNTSEKGVQPTILQAVKVDLYR 204

  Fly   177 QSQCASSTYGY-GSQIRNTMICAAAS--GKDACQGDSGGPLVSG-------GVLVGVVSWGYGCA 231
            ...|     || .|.:...|:||...  |||||||||||.||..       ...||:||||.||.
Mouse   205 WDWC-----GYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGMGCG 264

  Fly   232 YSNYPGVYADVAVLRSWV 249
            ..|.||||..|:....|:
Mouse   265 KKNLPGVYTKVSHYVRWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/237 (35%)
Prss52NP_082801.2 Tryp_SPc 56..285 CDD:238113 83/234 (35%)
Tryp_SPc 56..282 CDD:214473 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.