DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss32

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:252 Identity:88/252 - (34%)
Similarity:129/252 - (51%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL-QSVSASVLQVRAG-- 86
            |:..||||.|....:..:|||:|::.:|:|.||||:.:.:.::|||||. |..|.|:..|..|  
Mouse    48 PRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTI 112

  Fly    87 STYWSSG--GVVAKVSSFKNHEGYNANT-MVNDIAVIRLSSSLSFSSSIKAISLATYNPAN---- 144
            |:|....  ..:..|:.|..|..|:|:. ...|||:::|:|.:||:..:..:.|.  .|.:    
Mouse   113 SSYPEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLP--KPGDPLDP 175

  Fly   145 GASAAVSGWGTQSSGSS-SIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNT-------MICAA-- 199
            |....|:|||...:... ..|..||.:.|.::....|  :||...:.|..|       |:||.  
Mouse   176 GTMCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAETC--NTYYQENSIPGTEPVILEGMLCAGFQ 238

  Fly   200 ASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            ...||||.||||||||..    .:..||||||..||....||||.:|:|..||:.:|
Mouse   239 EGKKDACNGDSGGPLVCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/242 (35%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 84/242 (35%)
Tryp_SPc 54..295 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.