DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk10

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:119/257 - (46%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQL-------DGRIVGGSATTI-----------SSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            |||.|       ...::.|:||.:           ...|||:||..:....|.|.:...|.::||
Mouse    21 LLPLLMVQLWAAQALLLPGNATRVDLEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWVLTA 85

  Fly    70 AHCLQSVSASVLQVRAGSTY--WSSGGVVAKVSSFKNHEGYNA--------NTMVNDIAVIRLSS 124
            |||.::   ..|:.|.|..:  ......:...||...|..|.|        .:..:|:.:::|||
Mouse    86 AHCWRN---KPLRARVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLMMLKLSS 147

  Fly   125 SLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189
            .:..:|::..:.|.......|....||||||.:|........|....|.::||.||  .|: |..
Mouse   148 PVMLTSNVHPVQLPFRCSQPGQECQVSGWGTSASRRVKYNRSLSCSKVTLLSQKQC--ETF-YPG 209

  Fly   190 QIRNTMICAAASG-KDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWV 249
            .|.|:||||.|.| :|:||.|||||||....|.||:||| |.|..:.:|.||:::.....|:
Mouse   210 VITNSMICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPSVYSEICKYTPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/241 (31%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.