DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk12

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:271 Identity:85/271 - (31%)
Similarity:126/271 - (46%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANI 65
            ::..|||  ::||:|       |.|.| .:|..|.....:|.|||:.|.......|||.:.....
Mouse     1 MRFSILL--LLCAVG-------LSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKW 56

  Fly    66 IVTAAHCLQSVSASVLQVRAGS-------------------TYWSSGGVVAKVSSFKNHEGYNAN 111
            ::|||||...     ..||.|.                   |:.|..|      :::|||     
Mouse    57 VLTAAHCRDK-----YVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQG------AYQNHE----- 105

  Fly   112 TMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVS 176
               :|:.::||:..:..:.:::.::|.:.....||...||||||.:......|.:||.:|::.||
Mouse   106 ---HDLRLLRLNRPIHLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVS 167

  Fly   177 QSQCASSTYGYGSQIRNTMICAAA-SGKDACQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGV 238
            ...|.:.   :..::...|:||.. :||||||||||||||.||||.|:||||.  .|.....|||
Mouse   168 NETCRAV---FPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGV 229

  Fly   239 YADVAVLRSWV 249
            |..|.....|:
Mouse   230 YTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/240 (31%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.