DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss56

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:242 Identity:79/242 - (32%)
Similarity:113/242 - (46%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS-- 91
            |||||||.....::||.:.||..|...|||.:.:|:.::|||||....|..:|        |:  
Mouse   108 GRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELL--------WTVM 164

  Fly    92 -------SGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGAS 147
                   ......:|:....|..::..|..||:|:::|.:.:|.....:.|.|  .:..|..|..
Mouse   165 LAEGPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEGPARPICLPQGSREPPAGTP 229

  Fly   148 AAVSGWGTQ-SSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGD 209
            .|::|||.. ..|..|  ..::...|.::|...| ....|.|.: .:||:||.  |.|.|:||||
Mouse   230 CAIAGWGALFEDGPES--EAVREARVPLLSADTC-QKVLGPGLR-PSTMLCAGYLAGGIDSCQGD 290

  Fly   210 SGGPLVSG-------GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |||||...       .||.||.|||.||.....||||..|.|.:.|:
Mouse   291 SGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/239 (32%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.