DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk5

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:129/260 - (49%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQL--------------DGRIVGGSATTISSFPWQISLQRSGSH-SCGGSIYSANII 66
            ||.|.|....|              ..|||.||.....:.|||.:|....:. .||..:.|...:
Mouse    40 GTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWL 104

  Fly    67 VTAAHCLQSVSASVLQVRAG----STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            :|||||.:    .|.::|.|    |..:.||..:.:......|.||:.....||:.:|:::..:.
Mouse   105 LTAAHCRK----PVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIR 165

  Fly   128 FSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            .|.|:|.:.:|......|....||||||.||..::.|..||.:|:.::|:.:|.:|   |..||.
Mouse   166 DSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNS---YPGQID 227

  Fly   193 NTMICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVSTANS 255
            .||.||. ..|:|:||||||||:|..|.|.|:|||| :.||..|.||||.::.....|:..|.||
Mouse   228 KTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNS 292

  Fly   256  255
            Mouse   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/225 (36%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.