DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC683849

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:91/259 - (35%)
Similarity:138/259 - (53%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :..:::|:.|..|:...|.:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:
  Rat     1 MSALLILALVGTAVAFPVDD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVIRLSSS 125
            |:||||.:    |.:|||.|.   .:..|:.....|.|      |..::..|:.|||.:|:|||.
  Rat    59 VSAAHCYK----SRIQVRLGE---HNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSP 116

  Fly   126 LSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            :..::.:..::|.:.....|....:||||...|...:.|..||.::..::.|:.|.:|   |..:
  Rat   117 VKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEAS---YPGK 178

  Fly   191 IRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            |.:.|:||.  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:..|
  Rat   179 ITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIEDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/226 (37%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 84/226 (37%)
Tryp_SPc 24..242 CDD:238113 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.