DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss41

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:298 Identity:83/298 - (27%)
Similarity:131/298 - (43%) Gaps:65/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGG---------------------TVPEGLLPQLDGRIVGGSATTISSFPWQIS 47
            :::||..|||.:.|                     ::|.|....:..|||||..:....:|||.|
  Rat     7 MLLLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQAS 71

  Fly    48 LQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS-SGGVVAKVSSFKNHEGYNAN 111
            |:....|.||||:.|...::|||||.:..        .....|: ..|.:....||.|.|.::..
  Rat    72 LRLRKFHRCGGSLLSHRWVLTAAHCFRKF--------LDPKKWTVQLGQLTSKPSFWNREAFSGR 128

  Fly   112 TMVNDI-------------AVIRLSSSLSFSSSIKAI------SLATYNPANGASAAVSGWGTQS 157
            ..|.||             |::||:||::::..|:.:      |::.:.|    ...|:|||...
  Rat   129 YRVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQP----RCWVTGWGALQ 189

  Fly   158 SGSSSIPS--QLQYVNVNIVSQSQCASSTYGYGSQ---IRNTMICAAA--SGKDACQGDSGGPLV 215
            .....:|.  .|:.|.|.:::.|:| ...:.:.|:   |...:.||.|  ...|.|.||||||||
  Rat   190 EDLKPLPPPYHLREVQVTVLNLSRC-QELFSFASRYHLITRDVFCAGAEDGSADTCSGDSGGPLV 253

  Fly   216 SG--GV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..  |:  .:|:||.|.||.....||:|.:|:....|:
  Rat   254 CNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 74/249 (30%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 74/249 (30%)
Tryp_SPc 55..292 CDD:238113 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.