DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and st14a

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:286 Identity:104/286 - (36%)
Similarity:137/286 - (47%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALGG--TVPEGLLPQLDG-----------------------RIVGGSATTISSFPWQI 46
            |:|..:|....  |.|.   |:.||                       |||||.......||||:
Zfish   551 LVSTFLCGNSKCITKPN---PECDGQDDCGDNSDESNCNCGTKAYKKSRIVGGQDAFEGEFPWQV 612

  Fly    47 SLQ-RSGSHSCGGSIYSANIIVTAAHCLQ-SVSASVLQVRAGSTYWSSGGVVAKVSSFKN----- 104
            ||. ::.:|.|||||.:...|||||||:| .|.....|......:........|:::.|.     
Zfish   613 SLHIKNIAHVCGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFLGLHSQKDKLTATKRLLKQV 677

  Fly   105 --HEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYN---PANGASAAVSGWGTQSSGSSSIP 164
              |..|||.|..||||::.:.|.::||.:|:.:.|.|..   || |.|..:||||....|.|. .
Zfish   678 IPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPA-GTSVFISGWGATREGGSG-A 740

  Fly   165 SQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPL--VSGG--VLVGV 223
            :.||...|.|::.:.|...   .|.||.:.|.||.  :.|.|||||||||||  .||.  .|.||
Zfish   741 TVLQKAEVRIINSTVCNQL---MGGQITSRMTCAGVLSGGVDACQGDSGGPLSFPSGKRMFLAGV 802

  Fly   224 VSWGYGCAYSNYPGVYADVAVLRSWV 249
            ||||.|||..|.||:|::|...|:|:
Zfish   803 VSWGDGCARRNKPGIYSNVPKFRAWI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 95/236 (40%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060 8/36 (22%)
Tryp_SPc 596..828 CDD:214473 95/236 (40%)
Tryp_SPc 597..831 CDD:238113 95/237 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.