DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:256 Identity:98/256 - (38%)
Similarity:139/256 - (54%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :|.:|.|:.:..|:  .:|   |...|.:||||.....::.|:|:|| .||.|.||||:.::..:
Mouse     1 MKTLIFLAFLGAAV--ALP---LDDDDDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWV 59

  Fly    67 VTAAHCLQSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSF 128
            |:||||.:    |.:|||.|.   .....|......:....|..|||||..|||.:|:|.::.:.
Mouse    60 VSAAHCYK----SRIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATL 120

  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            :|.:..::|....|:.|....|||||...|..::.||.||.::..::|.|.|.||   |..:|.:
Mouse   121 NSRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSS---YPGKITS 182

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            .|.|..  ..|||:||||||||:|..|.|.||||||||||....||||..|....:|:..|
Mouse   183 NMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 89/223 (40%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 89/223 (40%)
Tryp_SPc 25..243 CDD:238113 90/225 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.