DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and prss1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:259 Identity:107/259 - (41%)
Similarity:149/259 - (57%) Gaps:18/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            :|..|||:....|....:.:.     |.:||||...|.:..|:|:|| .||.|.||||:.|...:
Zfish     1 MKAFILLALFAVAYAAPLGDD-----DDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWV 59

  Fly    67 VTAAHCLQSVSASVLQVRAGS-TYWSSGGVVAKVSSFK--NHEGYNANTMVNDIAVIRLSSSLSF 128
            |:||||.:    |.:|||.|. ....:.|....::|.|  .|..||:||:.||:.:|:||||...
Zfish    60 VSAAHCYK----SRVQVRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQI 120

  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193
            :|.:|.:||.:...::|.|..:||||..|:..|:.||:|..:|..|:|.|.|.::   |..||.:
Zfish   121 NSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNA---YPGQISS 182

  Fly   194 TMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANS 255
            .|.||.  ..|||:||||||||:|....|.|:||||||||..|.|||||.|....:|:.:|.||
Zfish   183 NMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRNTMNS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 97/223 (43%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 97/223 (43%)
Tryp_SPc 25..243 CDD:238113 98/225 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.