DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TMPRSS3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:265 Identity:88/265 - (33%)
Similarity:122/265 - (46%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            |:.|....|        |.......|||||:.:.:|.:|||.|||..|.|.||||:.:...|:||
Human   199 VVTLQCTAC--------GHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITA 255

  Fly    70 AHCLQSV---SASVLQVRAGSTYWSSGGVVA---------KVSSFKNHEGYNANTMVNDIAVIRL 122
            |||:..:   .:..:||          |:|:         .|.....|..|....:.||||:::|
Human   256 AHCVYDLYLPKSWTIQV----------GLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKL 310

  Fly   123 SSSLSFSSSIKAISL--ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            :..|:|:..|:.:.|  :..|..:|.....||||....|:......|.:..|.::|...|.....
Human   311 AGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDV 375

  Fly   186 GYGSQIRNTMICAA--ASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVAV 244
             ||..|..:|:||.  ..|.|:||||||||||..    ..|||..|:|.|||..|.||||..|..
Human   376 -YGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTS 439

  Fly   245 LRSWV 249
            ...|:
Human   440 FLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/238 (35%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 4/18 (22%)
Tryp_SPc 216..444 CDD:214473 83/238 (35%)
Tryp_SPc 217..447 CDD:238113 83/239 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.