DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS56

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:251 Identity:84/251 - (33%)
Similarity:123/251 - (49%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWS-- 91
            ||||||||....::||.:.||..|...|||.:.:|:.::|||||.......:|        |:  
Human   103 GRIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCFVGAPNELL--------WTVT 159

  Fly    92 ----SGGVVAK---VSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGAS 147
                |.|..|:   |:....|..::..|..||:|:::|.:.:|...|.:.:.|  ....|..|.:
Human   160 LAEGSRGEQAEEVPVNRILPHPKFDPRTFHNDLALVQLWTPVSPGGSARPVCLPQEPQEPPAGTA 224

  Fly   148 AAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR-NTMICAA--ASGKDACQGD 209
            .|::|||..........: ::...|.::|...|..:   .|..:| :||:||.  |.|.|:||||
Human   225 CAIAGWGALFEDGPEAEA-VREARVPLLSTDTCRRA---LGPGLRPSTMLCAGYLAGGVDSCQGD 285

  Fly   210 SGGPLVSG-------GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV---VSTANS 255
            |||||...       .||.||.|||.||.....||||..|||.:.|:   :|.|:|
Human   286 SGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQMSAASS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/239 (33%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96
Tryp_SPc 105..335 CDD:238113 79/241 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.