DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TPSB2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:273 Identity:90/273 - (32%)
Similarity:134/273 - (49%) Gaps:30/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVP-EGLLPQLDGRIVGGSATTISSFPWQISLQ---RSGSHSCGGSIY 61
            ||.:::|...|:.:.....| .|...|..| ||||.....|.:|||:||:   |...|.||||:.
Human     1 MLNLLLLALPVLASRAYAAPAPGQALQRVG-IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLI 64

  Fly    62 SANIIVTAAHC----LQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRL 122
            ....::|||||    ::.::|..:|:|....|:..  .:..||....|..:....:..|||::.|
Human    65 HPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQD--QLLPVSRIIVHPQFYTAQIGADIALLEL 127

  Fly   123 SSSLSFSSSIKAISL----ATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCAS 182
            ...::.||.:..::|    .|:.|  |....|:||| ..:......|..|:.|.|.|:....| .
Human   128 EEPVNVSSHVHTVTLPPASETFPP--GMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-D 189

  Fly   183 STYGYGSQ-------IRNTMICAAASGKDACQGDSGGPL---VSGGVL-VGVVSWGYGCAYSNYP 236
            :.|..|:.       :|:.|:||..:.:|:|||||||||   |:|..| .||||||.|||..|.|
Human   190 AKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRP 254

  Fly   237 GVYADVAVLRSWV 249
            |:|..|.....|:
Human   255 GIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/241 (34%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 82/242 (34%)
Tryp_SPc 31..267 CDD:214473 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.