DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and zgc:123295

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:272 Identity:104/272 - (38%)
Similarity:152/272 - (55%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALG--GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRS--GSHSCGGSIYSAN 64
            :::.::..:|.|.  |..|      |:.:||||......|:|||:|||..  |.|.||||:.:.:
Zfish    13 LLVNIAGSLCQLNVCGRAP------LNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKD 71

  Fly    65 IIVTAAHCLQSVSASV-----LQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            .:::||||.|....::     ||.::||..:.....|.:|.   ||..||..:..||||:::|.|
Zfish    72 WVLSAAHCFQDSIGTIMVKLGLQSQSGSNPYQITKTVVQVI---NHPNYNNPSNDNDIALVKLDS 133

  Fly   125 SLSFSSSIKAISLA----TYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            |::|:..|:.:.||    ||  |.|..:.|:|||..||.::.||..||.|.:.|||.|.|..:  
Zfish   134 SVTFNDYIEPVCLAAAGNTY--AAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRA-- 194

  Fly   186 GYGSQIRNTMICAA---ASGKDACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVA 243
             |..:|.:.||||.   ..|||:||||||||:||..    :..|:||:|.|||...||||||.|:
Zfish   195 -YPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVS 258

  Fly   244 VLRSWVVSTANS 255
            ..:.|:.|:..|
Zfish   259 QYQDWITSSTGS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 96/236 (41%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 96/236 (41%)
Tryp_SPc 36..264 CDD:238113 96/235 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.