DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CELA2A

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:277 Identity:94/277 - (33%)
Similarity:151/277 - (54%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS----HSCGGSIY 61
            |::.::|.:.|..||....|  ..|....|:|||.....:|:|||:|||.|.:    |:||||:.
Human     1 MIRTLLLSTLVAGALSCGDP--TYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLI 63

  Fly    62 SANIIVTAAHCLQSVSASVLQVRAGSTYWS-SGGVVAKVSSFKNHEGYNANTMV--NDIAVIRLS 123
            :.:.::|||||:.|.....:.:...:.|.: ||.:...||....|:.:|:|.:.  ||||:::|:
Human    64 ANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLA 128

  Fly   124 SSLSFSSSIKAISLATYNPA-----NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCAS 182
            :.:|.:..|:   ||...||     |.....|:||| .|::|  ::|..||...:.:|..:.|:|
Human   129 NPVSLTDKIQ---LACLPPAGTILPNNYPCYVTGWGRLQTNG--AVPDVLQQGRLLVVDYATCSS 188

  Fly   183 STYGYGSQIRNTMICAAASGK-DACQGDSGGPL---VSGG--VLVGVVSWG--YGCAYSNYPGVY 239
            |.: :||.::.:||||...|. .:|.|||||||   .|.|  .:.|:||:|  .||.|.:.|.|:
Human   189 SAW-WGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVF 252

  Fly   240 ADVAVLRSWVVST-ANS 255
            ..|:....|:.|. ||:
Human   253 TRVSNYIDWINSVIANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/239 (35%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.