DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG17239

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:252 Identity:117/252 - (46%)
Similarity:147/252 - (58%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            :.|..:|.......:||        |||||...||.|.|||.|:.|.|...||.:|||.:|::||
  Fly     6 IFLAFSVTVVSSNWIPE--------RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITA 62

  Fly    70 AHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKA 134
            ||||.......|.||.||::...||.|.:|||...||.|: .:..|||||:||.|.|...|::..
  Fly    63 AHCLTDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYD-QSWSNDIAVMRLQSKLRLGSAVSV 126

  Fly   135 ISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA 199
            |.||...||:|:.|.|||||. .....:.|..:...:|:||.|.||..|   ||.:|...|||||
  Fly   127 IPLADTPPASGSPATVSGWGA-IGFKKNYPMSILSASVDIVDQDQCRRS---YGRKITKDMICAA 187

  Fly   200 ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            |.|||||.||||||||||..|||:||:|..||:..||||||:||.|:.|::.....|
  Fly   188 APGKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 111/218 (51%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 111/218 (51%)
Tryp_SPc 24..237 CDD:238113 110/217 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443190
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.