DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG18735

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:234 Identity:89/234 - (38%)
Similarity:118/234 - (50%) Gaps:18/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGG 94
            |||||..|.:..:||.|.|...|:..||.|:.:....:|||||:......::.||..........
  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146

  Fly    95 VV---AKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPAN---GASAAVSGW 153
            |.   .:||....|..|:.....:|||:||.:..:.....:..:.:.|  |:.   |.:|.|:||
  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT--PSENYAGQTAVVTGW 209

  Fly   154 GTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA---ASGKDACQGDSGGP-- 213
            |..|.| ..|...||.|.|.|:||.:|.:|.|| .|:|.:.||||.   ..|||:||||||||  
  Fly   210 GALSEG-GPISDTLQEVEVPILSQEECRNSNYG-ESKITDNMICAGYVEQGGKDSCQGDSGGPMH 272

  Fly   214 -LVSGGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
             |.||..  |.|:||||.|||..|.||||..|.....|:
  Fly   273 VLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/232 (38%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/232 (38%)
Tryp_SPc 83..314 CDD:238113 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.