DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG34458

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:259 Identity:92/259 - (35%)
Similarity:137/259 - (52%) Gaps:14/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANI 65
            ::|:.|||.||.     .|...:....:.||:||.......||.|:|||.:|.|.||||:.|..:
  Fly     7 LVKLSILLLAVT-----FVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTM 66

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSG-GVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFS 129
            |||||||....:...::...|:...|:| |....::.|..|..||..:...|:::|:|||.:...
  Fly    67 IVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMG 131

  Fly   130 SSIKAISLA--TYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            .:::.|.||  ..|.|....|.:||:|..:. :..:|::|::..|.:.|:..|.|...   ..:.
  Fly   132 GAVQTIQLADSDSNYAADTMAMISGFGAINQ-NLQLPNRLKFAQVQLWSRDYCNSQNI---PGLT 192

  Fly   193 NTMICAA-ASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTAN 254
            :.|:||. .||: .:|||||||||...|.|.||||||:||.....|.:|..|..||||:...||
  Fly   193 DRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/223 (37%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 82/223 (37%)
Tryp_SPc 32..254 CDD:238113 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452430
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.