DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CG34295

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097956.1 Gene:CG34295 / 5740413 FlyBaseID:FBgn0085324 Length:288 Species:Drosophila melanogaster


Alignment Length:205 Identity:39/205 - (19%)
Similarity:75/205 - (36%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVI 120
            |..::.:.::.:|::.|..:.|...||:     .::.|..:|                |:::...
  Fly    93 CSAALVAPSLAITSSKCFSNDSFKPLQI-----IFTGGRTIA----------------VDNVVKA 136

  Fly   121 RLSSSLSF-----SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYV---NVNIVSQ 177
            .....||.     .|.|..|:|..|:...|...::          ....|.|:|.   ...|:|.
  Fly   137 DFCPELSILHLKRPSEINPIALCQYDVPLGTRVSM----------MMATSDLRYYGRRRTEIISN 191

  Fly   178 SQCASSTYGYGSQ-IRNTMICAAAS-GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPG-VY 239
            ..|.::.....|. |..:|:||..| ..:.|....|..|:....|.|:..:|:.|..:...| :|
  Fly   192 RACKTTFLEEDSVFITPSMLCAKNSMNPEMCATSPGDVLLIDHQLCGLNVYGFRCFQNALNGDLY 256

  Fly   240 ADVAVLRSWV 249
            ..:..|:..:
  Fly   257 ISLGKLQPMI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 39/203 (19%)
CG34295NP_001097956.1 Tryp_SPc 78..>213 CDD:304450 26/150 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.