DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tmprss5

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:271 Identity:100/271 - (36%)
Similarity:139/271 - (51%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            ||.|....|.....:|         ||:||....:..:|||:||..:..|.|||||.:...||||
Zfish   295 VIALKCFECGTRAKLP---------RIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTA 350

  Fly    70 AHCLQSVSASVLQVRAGSTYWSSGGVV----AKVSSFKN--------HEGYNANTMVNDIAVIRL 122
            |||:.:.  .:.||.:...|   .|::    ||::.::.        ::.||..|..||||:::|
Zfish   351 AHCVHNY--RLPQVPSWVVY---AGIITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKL 410

  Fly   123 SSSLSFSSSIKAISLATYNP--ANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            .:.|:||.:|:.:.|..|:.  ..|....:||||........||..|:...|.::|..:|.||..
Zfish   411 KTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCM 475

  Fly   186 GYGSQIRNTMICAAAS-GK-DACQGDSGGPLVSGGV----LVGVVSWGYGCAYSNYPGVYADVAV 244
             |..:|.:.|:||..| || ||||||||||||....    ||||||||.|||..|:||||:.||.
Zfish   476 -YNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAE 539

  Fly   245 LRSWVVSTANS 255
            ...|:.....|
Zfish   540 FLGWIYDIIES 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 93/238 (39%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 4/10 (40%)
Tryp_SPc 311..544 CDD:214473 93/238 (39%)
Tryp_SPc 312..547 CDD:238113 93/240 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.