DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP001245

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001689377.2 Gene:AgaP_AGAP001245 / 5667668 VectorBaseID:AGAP001245 Length:272 Species:Anopheles gambiae


Alignment Length:272 Identity:108/272 - (39%)
Similarity:157/272 - (57%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCAL--------------GGTVPEGL--LPQLDGRIVGGSATTISSFPWQISLQRSG 52
            ::.|.:|.|.||              |....:||  ||...|||.||....|:::|:|:||:|: 
Mosquito     6 VLALFAAGVAALTEEEVWLQYNRRMPGEYYTKGLVELPPFQGRIFGGVEADIANYPYQLSLRRA- 69

  Fly    53 SHSCGGSIYSANIIVTAAHCLQSVSA-SVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVND 116
            |||||.|:.|||..::||||...|.| .|:.::.||:..:|||||.:|....||..|:...:|||
Mosquito    70 SHSCGASVISANWALSAAHCTFPVPAPGVITLQGGSSDRTSGGVVFQVEQIINHPQYDDWNLVND 134

  Fly   117 IAVIRLSSSLSFSSSIKAISL----ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQ 177
            :.|:|.::.|| ..:|..|:|    ||:  |.|:.|.:||||...  .|.:|:.|:.|::.:|.|
Mosquito   135 VCVLRTTTPLS-GVNIAIIALDPVGATH--AVGSRAVLSGWGLME--GSVLPAILRRVDIPVVDQ 194

  Fly   178 SQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADV 242
            ..| .:.:|.| .:...||||:..|:|||.||||||||.||..:|:||||........|||:|.|
Mosquito   195 GAC-ETAWGSG-WVTPDMICASEPGRDACNGDSGGPLVVGGQQIGIVSWGDTQCVGTRPGVFARV 257

  Fly   243 A--VLRSWVVST 252
            |  ::|:|:..|
Mosquito   258 AFPLIRNWIAQT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 95/225 (42%)
AgaP_AGAP001245XP_001689377.2 Tryp_SPc 48..266 CDD:214473 95/225 (42%)
Tryp_SPc 49..269 CDD:238113 95/227 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.