DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP005703

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001688713.1 Gene:AgaP_AGAP005703 / 5667317 VectorBaseID:AGAP005703 Length:289 Species:Anopheles gambiae


Alignment Length:235 Identity:61/235 - (25%)
Similarity:106/235 - (45%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISL---QRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTY 89
            |.||..|...:.:..||.:.|   ..||:..|||::.|...::|||.|:...| |:..:...||.
Mosquito    49 DRRINNGQIASPTDAPWAVGLLVSLASGTSFCGGALISPTHVLTAASCVNGQS-SITAMLGASTI 112

  Fly    90 WSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATY----NPANGASAAV 150
            .::...| .|:..:.|..|::....:|||::.||....::..|:.|:|...    :..|.....:
Mosquito   113 ATTSDFV-PVAHVRVHPDYSSFLERDDIAILTLSRQPRWNDQIQIINLPRRMYIGHSFNNYVTTI 176

  Fly   151 SGWG-TQSSGSSSIP-SQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGP 213
            |||| |.::....:| ..|:::...:::...|..|.  ..:.||:|.||.|..|...|.||.|.|
Mosquito   177 SGWGETGTNTGEPLPMPNLRFIRSPVITNLSCELSF--LLTNIRSTHICTATDGGAPCVGDQGAP 239

  Fly   214 --LVSGG--VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
              :...|  .|:|:..:.........|.|:..:....:|:
Mosquito   240 VTVTENGETFLIGIHVFTASRCERGRPAVHVRLTEYMNWL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 59/231 (26%)
AgaP_AGAP005703XP_001688713.1 Tryp_SPc 51..278 CDD:214473 59/230 (26%)
Tryp_SPc 52..282 CDD:238113 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.