DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TMPRSS4

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:257 Identity:81/257 - (31%)
Similarity:127/257 - (49%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            ::.|..:.|......|         |:||....::.|:|||:|:|....|.|||||...:.::||
Human   188 LVSLHCLACGKSLKTP---------RVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTA 243

  Fly    70 AHCLQS-VSASVLQVRAGSTYWSS--GGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSS 131
            |||.:. ......:|||||....|  ...|||:...:.:..|..:   ||||:::|...|:||.:
Human   244 AHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKD---NDIALMKLQFPLTFSGT 305

  Fly   132 IKAISLATYN----PANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ::.|.|..::    ||  ....:.|||........:...|...:|.::..::| ::...|..::.
Human   306 VRPICLPFFDEELTPA--TPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRC-NADDAYQGEVT 367

  Fly   193 NTMICAA--ASGKDACQGDSGGPLV---SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..|:||.  ..|.|.|||||||||:   ....:||:|||||||...:.||||..|:...:|:
Human   368 EKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 77/230 (33%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 1/8 (13%)
Tryp_SPc 204..429 CDD:214473 77/230 (33%)
Tryp_SPc 205..432 CDD:238113 77/231 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.