DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AZU1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:272 Identity:80/272 - (29%)
Similarity:120/272 - (44%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANI 65
            |.::.:|  |::..|..:...|..|.||  ||||.......||:..|:|..|.|.|||::..|..
Human     1 MTRLTVL--ALLAGLLASSRAGSSPLLD--IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARF 61

  Fly    66 IVTAAHCLQSVSASVLQVRAGS------------TYWSSGGVVAKVSSFKNHEGYNANTMVNDIA 118
            ::|||.|.||.:..|..|..|:            |:        .:||. :..||:....:||:.
Human    62 VMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTF--------SISSM-SENGYDPQQNLNDLM 117

  Fly   119 VIRLSSSLSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSGS--SSIPSQLQYVNVNIVSQSQ 179
            :::|....:.:||:..:.|...|..  .|....|:|||:|.||.  |..|   ::|||.:..:.|
Human   118 LLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFP---RFVNVTVTPEDQ 179

  Fly   180 CASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVA 243
            |..:....|...|...|         |.||.|.|||..|:..||.|:..| |...  |..:..||
Human   180 CRPNNVCTGVLTRRGGI---------CNGDGGTPLVCEGLAHGVASFSLGPCGRG--PDFFTRVA 233

  Fly   244 VLRSWVVSTANS 255
            :.|.|:....|:
Human   234 LFRDWIDGVLNN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/235 (30%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 71/235 (30%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.