DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRTN3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:274 Identity:82/274 - (29%)
Similarity:125/274 - (45%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSANI 65
            :.:|||....|              ..||||......|.|:..|||   ..|||.|||::...:.
Human    15 LALLLSGAARA--------------AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSF 65

  Fly    66 IVTAAHCLQSVSASVLQVRAGS----------TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVI 120
            ::||||||:.:...::.|..|:          .::|    ||:|  |.|:  |:|...:||:.:|
Human    66 VLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFS----VAQV--FLNN--YDAENKLNDVLLI 122

  Fly   121 RLSSSLSFSSSIKAISLATYNP--ANGASAAVSGWGTQSSGSSSIPSQ-LQYVNVNIVSQSQCAS 182
            :|||..:.|:|:..:.|...:.  .:|......|||  ..|:...|:| ||.:||.:|: ..|  
Human   123 QLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWG--RVGAHDPPAQVLQELNVTVVT-FFC-- 182

  Fly   183 STYGYGSQIRNTMICAAASGKDA--CQGDSGGPLVSGGVLVGV---VSWGYGCAYSNYPGVYADV 242
                     |...||.....:.|  |.|||||||:..|::.|:   |.|  |||...:|..:..|
Human   183 ---------RPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFTRV 236

  Fly   243 AVLRSWVVSTANSI 256
            |:...|:.||...:
Human   237 ALYVDWIRSTLRRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/239 (31%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.