DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS8

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:269 Identity:98/269 - (36%)
Similarity:135/269 - (50%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAH 71
            ||.:...|.|...|.|:.||  .||.|||:.....:|||:|:...|.|.||||:.|...:::|||
Human    23 LLRSGTGAEGAEAPCGVAPQ--ARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAH 85

  Fly    72 CLQSV-SASVLQVRAGSTYWSSGGVVAKVSSFKN---HEGYNANTMVNDIAVIRLSSSLSFSSSI 132
            |..|. .....:|:.|:....|....||||:.|:   |..|.......|||:::||..::||..|
Human    86 CFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYI 150

  Fly   133 KAISLATYNPA--NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ---- 190
            :.|.|...|.:  ||....|:||| ...|.|...|..||.:.|.::|:..| :..|...::    
Human   151 RPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETC-NCLYNIDAKPEEP 214

  Fly   191 --IRNTMICA--AASGKDACQGDSGGPL---VSG-GVLVGVVSWGYGCAYSNYPGVYADVAVLRS 247
              ::..|:||  ...|||||||||||||   |.| ..|.|:||||..|...|.||||...:...|
Human   215 HFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYAS 279

  Fly   248 WVVSTANSI 256
            |:.|....:
Human   280 WIQSKVTEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/237 (37%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 88/237 (37%)
Tryp_SPc 45..284 CDD:238113 88/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.