DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and TMPRSS15

DIOPT Version :10

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001414985.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:77 Identity:12/77 - (15%)
Similarity:30/77 - (38%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRKAFTAKERLIVTLR--FLATGESFMALASLYDISASSIRTIIPEVCECLIKALKRYVQSNCHG 112
            :|:....:||..:.::  .....::..|........|..:..:..|:.:|   .|::::|.....
Human   246 LRQDLAIQERHSLEMQGTLALVSQALEAAEHALQAQAQELEELNRELRQC---NLQQFIQQTGAA 307

  Fly   113 YLTPATVSRTQS 124
            ...|..:.||.:
Human   308 LPPPPQLDRTST 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 12/77 (16%)
TMPRSS15NP_001414985.1 None

Return to query results.
Submit another query.