DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:270 Identity:83/270 - (30%)
Similarity:122/270 - (45%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            |:..:||  :|..|.|:..:        ||:||......|..:|.|:|.:..|.|||::.....:
Zfish     5 LEYTLLL--IVSMLQGSKQQ--------RIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWV 59

  Fly    67 VTAAHCLQSVSASVLQVRAGSTYWSSGGVV---------AKVSSFKN---------HEGYNANTM 113
            |:||||                 |....::         :|:..|:.         |..||..|.
Zfish    60 VSAAHC-----------------WRPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRTF 107

  Fly   114 VNDIAVIRLSSSLSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVS 176
            .:||.:::|......|::|:...|....||  .|....|||||.....|..:...|:.|:|.|:.
Zfish   108 DSDIMLLKLEKPAELSATIQPAVLPVSVPALQGGTVCIVSGWGVTQVYSYYLSPVLRAVDVQIIP 172

  Fly   177 QSQCASSTYGYGSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY 239
            |.|     |.|..:|.:.|:||.:  .|||:|||||||||:..|...|:||||..||.:.:||||
Zfish   173 QCQ-----YYYYYRITDNMVCAGSPLGGKDSCQGDSGGPLICNGYFEGIVSWGISCANAYFPGVY 232

  Fly   240 ADVAVLRSWV 249
            ..|.....|:
Zfish   233 TKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 76/240 (32%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 76/239 (32%)
Tryp_SPc 24..241 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.