DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:238 Identity:97/238 - (40%)
Similarity:135/238 - (56%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSS 92
            |.:||||.....:|.|:|:|| .||||.||||:.|...:|:||||.:    :.:|||.|.   .:
Human   107 DDKIVGGYTCEENSLPYQVSL-NSGSHFCGGSLISEQWVVSAAHCYK----TRIQVRLGE---HN 163

  Fly    93 GGVVAKVSSFKN------HEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVS 151
            ..|:.....|.|      |..||.:|:.|||.:|:|||....::.:..|||.|..||.|....:|
Human   164 IKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLIS 228

  Fly   152 GWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPL 214
            |||...|..:..|.:|:.::..:::|::|.:|   |..:|.|:|.|..  ..|||:||.|||||:
Human   229 GWGNTLSFGADYPDELKCLDAPVLTQAECKAS---YPGKITNSMFCVGFLEGGKDSCQRDSGGPV 290

  Fly   215 VSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST--ANS 255
            |..|.|.||||||:|||:.|.||||..|.....|:..|  |||
Human   291 VCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 91/226 (40%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 91/226 (40%)
Tryp_SPc 110..328 CDD:238113 92/228 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.