DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC562139

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:268 Identity:101/268 - (37%)
Similarity:138/268 - (51%) Gaps:27/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSANI 65
            |:..|:.:..|.|..|| .:.|.:.|  |||.|......|:|||:|||.| |.|.||||:.:...
Zfish     6 ILSCLALIGTAYGCGVP-AIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWW 69

  Fly    66 IVTAAHCLQSVSASVLQVRAGSTYWSSGG------VVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            :||||||....|..|:   .|....||..      .|.||  || |..:|..|:.|||.:|:|::
Zfish    70 VVTAAHCNVRTSHRVI---LGEHDRSSNAEPIQTMTVGKV--FK-HPNFNMFTINNDILLIKLAT 128

  Fly   125 SLSFSSSIKAISLATYNP--ANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            ....::.:..:.||..|.  ..|.....||||.....:...|:.||...:.:::...|...   :
Zfish   129 PAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDCKRF---W 190

  Fly   188 GSQIRNTMICAAASGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSW 248
            |::|.:.|:||.|||..:|.||||||||  ..||  |||:||||.....::.|||||.|..||:|
Zfish   191 GNKITDLMVCAGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSVCSTSSPGVYARVTKLRAW 255

  Fly   249 V--VSTAN 254
            |  ..|||
Zfish   256 VDQTITAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/231 (38%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 88/231 (38%)
Tryp_SPc 34..259 CDD:238113 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.