DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tmprss9

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:252 Identity:90/252 - (35%)
Similarity:128/252 - (50%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG 86
            |..|.:..|||||..|....||||:||:..|.|:||.||.::..:|:||||        .:|...
Zfish   223 GTRPVMSNRIVGGENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHC--------FEVENN 279

  Fly    87 STYWS--------SG----GVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLAT 139
            ...|:        ||    ..:..:.|......|:..|..:|:.|:.|.:.|.||..::.:.:.:
Zfish   280 PKDWTALVGANQVSGAEAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPS 344

  Fly   140 ----YNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAA 200
                :.|  |.:..|||||..:..::.:||.||...|.|:....|..|:...|:..:|.|.....
Zfish   345 SSHVFTP--GQNCIVSGWGALNQYTTEVPSTLQKAIVKIIDSKVCNKSSVYRGALTQNMMCAGFL 407

  Fly   201 SGK-DACQGDSGGPL---VSGG--VLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            .|| |:|||||||||   |:.|  .|.|:||||.|||..|.||||:.|..||:|:||
Zfish   408 QGKVDSCQGDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWIVS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 85/240 (35%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 84/239 (35%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.