DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and KLK15

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:242 Identity:83/242 - (34%)
Similarity:122/242 - (50%) Gaps:24/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS-TYW 90
            || :::.|......|.|||::|...|..:||.|:.|.:.:::||||    .:..::||.|. ...
Human    18 DGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHC----QSRFMRVRLGEHNLR 78

  Fly    91 SSGG--VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGW 153
            ...|  .:...|....|..|.|.:..|||.::||......:..::...|.|..|..|.:..||||
Human    79 KRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGW 143

  Fly   154 GTQS------SGSS----SIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGK--DAC 206
            |..|      :||.    |:|..|...|::|:|.:.|..|   |..::.|||:||.|.|:  ::|
Human   144 GLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKS---YPGRLTNTMVCAGAEGRGAESC 205

  Fly   207 QGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVST 252
            :||||||||.||:|.|:|||| ..|..:..||||..|.....|:..|
Human   206 EGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRET 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/234 (34%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.