DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and ctrb.3

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:257 Identity:101/257 - (39%)
Similarity:138/257 - (53%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVV---CALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSANI 65
            |||.|.   .|.|..|| .:.|.:.|  |||.|......|:|||:|||. :|.|.||||:.:...
Zfish     6 LLSCVAFFSAAYGCGVP-AIPPVVSGYARIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFW 69

  Fly    66 IVTAAHCLQSVSASVL--QVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSF 128
            :||||||....|..|:  :...|.:.........|||....|..||:||:.||||:::|::..|.
Zfish    70 VVTAAHCSVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASL 134

  Fly   129 SSSIKAISL--ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            ::.:..:.|  |:.|.|:|.:...||||.....:...|.:||.|.:.::|...|.:.   :||.|
Zfish   135 NAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNH---WGSNI 196

  Fly   192 RNTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |:|||||.|:|..:|.||||||||    :...|||:||||........||||..|..||.||
Zfish   197 RDTMICAGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 89/227 (39%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 89/227 (39%)
Tryp_SPc 34..261 CDD:238113 90/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.