DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and prss8

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:272 Identity:103/272 - (37%)
Similarity:134/272 - (49%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVVCALG----GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIV 67
            |||.::.|:.    |...||    :..|||||...:...||||.||:..|:|.||.::.|||.||
 Frog     6 LLSLLLLAVSHFELGRSQEG----VQSRIVGGHDASEGMFPWQASLRYDGNHVCGAALISANFIV 66

  Fly    68 TAAHCL--------QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            |||||.        .||...|||:...    ||...:.|:.....:..|:.:|...|:||..|.|
 Frog    67 TAAHCFPSDHSLVGYSVYLGVLQLGVP----SSNSQLLKLKQVTIYPSYSHDTSSGDLAVAALDS 127

  Fly   125 SLSFSSSIKAISLATYN---PANGASAAVSGWGTQSSGSSSIP--SQLQYVNVNIVSQSQC---- 180
            ..:||..::.|||...|   |. |.:..|:|||....| .::|  ..||..||.::.:..|    
 Frog   128 PATFSHVVQPISLPAANVQFPI-GMTCQVTGWGNIQQG-VNLPGAKNLQVGNVKLIGRQTCNCLY 190

  Fly   181 --ASSTYGYGSQIRNTMICA--AASGKDACQGDSGGPL---VSG-GVLVGVVSWGYGCAYSNYPG 237
              ..|....|| |:..||||  ||...|||||||||||   |:| ..|..|||||..|...|.||
 Frog   191 NIKPSADSMGS-IQPDMICAGSAAGSVDACQGDSGGPLTCTVNGKAYLAAVVSWGDECGAQNKPG 254

  Fly   238 VYADVAVLRSWV 249
            ||..::...||:
 Frog   255 VYILISAYASWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 95/243 (39%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 95/243 (39%)
Tryp_SPc 30..269 CDD:238113 95/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.