DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Mcpt4

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_062194.1 Gene:Mcpt4 / 54270 RGDID:3064 Length:246 Species:Rattus norvegicus


Alignment Length:267 Identity:67/267 - (25%)
Similarity:108/267 - (40%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPW----QISLQRSGSHSCGGSIYS 62
            :|.::.|.|::...|....|         |:||..:...|.|:    :|..:......|||.:.|
  Rat     1 MKALLFLMALLLPSGAGAEE---------IIGGVESIPHSRPYMALLKIVTEEGHVTFCGGFLIS 56

  Fly    63 ANIIVTAAHCLQSVSASVLQVRAGSTYWSSG-------GVVAKVSSFKNHEGYNANTMVNDIAVI 120
            ...::|||||    ....:.|..|:...|..       .||.::...|    ||..:...||.::
  Rat    57 LQFVLTAAHC----HGREITVTLGAHDMSKRESTQQKIKVVKQIFPLK----YNLFSNFRDIMLL 113

  Fly   121 RLSSSLSFSSSIKAISLATYNPAN------GASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQ 179
            :|......:.|:..|.|    |.:      |.....:||| |:.......:.|:.|.:.|:....
  Rat   114 KLEQKAVLTPSVNVIPL----PQSSDIIKPGTMCLAAGWG-QTGVKEPNSNTLREVMLRIMEMKA 173

  Fly   180 CASSTYGYGSQIRNTMICAAASG--KDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADV 242
            |....: |.::.:   ||.....  |.|.:||||||||..||..|:||.|.|....  |.::..:
  Rat   174 CKDYRH-YDNRFQ---ICVGIPQMLKLAYKGDSGGPLVCAGVAHGIVSHGPGRGIP--PIIFTRI 232

  Fly   243 AVLRSWV 249
            :...||:
  Rat   233 SSYVSWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 61/237 (26%)
Mcpt4NP_062194.1 Tryp_SPc 20..239 CDD:214473 62/246 (25%)
Tryp_SPc 21..242 CDD:238113 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.