DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Cfd

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:129/257 - (50%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            |..:::|.|.||          :.|..|||:||......:.|:..|:|.:|:|.|||::.....:
  Rat     7 LVALVVLEAAVC----------VAQPRGRILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWV 61

  Fly    67 VTAAHCLQSVSA-SVLQVRAGSTYWSSGGV---VAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            ::||||:..|:. .|:||..|:...||...   :..|.|...|.|...:::.:|:.:.:||.:.|
  Rat    62 LSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNAS 126

  Fly   128 FSSSIKAISL----ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            ....::.:.|    ....|  |....|:|||..:..... |..||.:.|:|:.::.|...||..|
  Rat   127 LGPHVRPLPLQREDREVKP--GTLCDVAGWGVVTHAGRR-PDVLQQLTVSIMDRNTCNLRTYHDG 188

  Fly   189 SQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAVLRSWV 249
            :..:| |:||.::.:|.|:||||||||.|..:..||:||.. |.....|||:..||....|:
  Rat   189 AITKN-MMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 72/227 (32%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.