DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Elane

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:128/271 - (47%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVVCA--LGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAA 70
            |:|::.|  |||       |.|...||||......::|:..||||.|.|.||.::.:.|.:::||
Mouse    11 LAAMLLALFLGG-------PALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAA 68

  Fly    71 HCLQSVSASVLQV-----------RAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSS 124
            ||:..::...:||           |...|:     .|.::  |:|  |::.:.::|||.:|:|:.
Mouse    69 HCVNGLNFRSVQVVLGAHDLRRQERTRQTF-----SVQRI--FEN--GFDPSQLLNDIVIIQLNG 124

  Fly   125 SLSFSSSIKAISLATYNPANGASAA------VSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASS 183
            |.:.:::::...|    ||.|....      ..|||...:...| ||.||.:||.:|: :.|.  
Mouse   125 SATINANVQVAQL----PAQGQGVGDRTPCLAMGWGRLGTNRPS-PSVLQELNVTVVT-NMCR-- 181

  Fly   184 TYGYGSQIRNTMICAAASGKDA--CQGDSGGPLVSGGVLVGVVSW--GYGCAYSNYPGVYADVAV 244
                    |...:|.....:.|  |.||||||||...::.|:.|:  | ||....||..:|.||.
Mouse   182 --------RRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGLYPDAFAPVAE 237

  Fly   245 LRSWVVSTANS 255
            ...|:.|...|
Mouse   238 FADWINSIIRS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/239 (29%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/239 (29%)
Tryp_SPc 29..245 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.