DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Tmprss2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:277 Identity:95/277 - (34%)
Similarity:138/277 - (49%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIV 67
            ::|:.|..:.|.:...       :...|||||...:...:|||:||...|.|.|||||.:...||
Mouse   233 RMVVSLRCIECGVRSV-------KRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIV 290

  Fly    68 TAAHCLQSVSASVLQVRAGSTYWSS-GGVVA----------KVSSFKNHEGYNANTMVNDIAVIR 121
            |||||::...:|       ..||:: .|::.          :|....:|..|::.|..||||:::
Mouse   291 TAAHCVEEPLSS-------PRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMK 348

  Fly   122 LSSSLSFSSSIKAISLATYNPAN----GASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCA 181
            |.:.|:|:..:|.:.|.  ||..    .....:|||| |...|.:|  ..|....|.::..|:| 
Mouse   349 LQTPLAFNDLVKPVCLP--NPGMMLDLDQECWISGWGATYEKGKTS--DVLNAAMVPLIEPSKC- 408

  Fly   182 SSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVS--GGV--LVGVVSWGYGCAYSNYPGVYA 240
            :|.|.|.:.|...||||.  ....|:||||||||||:  .|:  |:|..|||.|||.:..||||.
Mouse   409 NSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYG 473

  Fly   241 DVAVLRSWVVS--TANS 255
            :|.|...|:..  .|||
Mouse   474 NVTVFTDWIYQQMRANS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/240 (37%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 3/13 (23%)
Tryp_SPc 254..485 CDD:238113 88/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.