DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Gzmbl1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038949997.1 Gene:Gzmbl1 / 502004 RGDID:1561819 Length:277 Species:Rattus norvegicus


Alignment Length:263 Identity:76/263 - (28%)
Similarity:118/263 - (44%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQISLQ----RSGSHSCGGSIY 61
            :|:::||          :...|.|:.. |.|:||.....:|.|:...||    .||:.:|||.:.
  Rat    30 MKLLLLL----------LTFSLAPRTQAGEIIGGHEANPNSRPYMAYLQIMDKDSGNKTCGGFLI 84

  Fly    62 SANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSL 126
            ..:.::||||||.|.....|.............|:..|.... |..|||.|:.|||.:::|.|..
  Rat    85 RKDFVLTAAHCLGSKIIVTLGAHNIKEQEKKQQVIPVVKIIP-HPAYNAKTISNDIMLLKLKSKA 148

  Fly   127 SFSSSIKAISL--ATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS---STYG 186
            ..:|::|.::|  :.:....|....|:||| :.......|..||.|.:.:....:|.|   :.|.
  Rat   149 KRTSAVKTLNLPRSNFKVKPGDVCYVAGWG-KLGPMGEFPDTLQEVELTVQEDQKCESHLTNVYD 212

  Fly   187 YGSQIRNTMICAAASG--KDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ..::     |||....  :.:.|||||||||...|..|:||  ||....:.|..:..|:...||:
  Rat   213 KANE-----ICAGDPNIKRASFQGDSGGPLVCKKVAAGIVS--YGRKDGSTPREFTKVSTFLSWI 270

  Fly   250 VST 252
            ..|
  Rat   271 KKT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 68/229 (30%)
Gzmbl1XP_038949997.1 Tryp_SPc 50..273 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.