DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss44

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:234 Identity:82/234 - (35%)
Similarity:125/234 - (53%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGG 94
            |||||....|..:|||:|||....|.||||:.|...::|||||:......|:.: ..:..|||..
  Rat   112 RIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGHLDYVVSM-GEADLWSSMS 175

  Fly    95 VVAKVSSFKNHEGYNA-NTMVNDIAVIRLSSSLSFSSSIKAISL--ATYNPANGASAAVSGWG-T 155
            |...|.....|:.|:. .|:|:|||::.|:..:::|.:|:.:.:  .::....|....|:||| |
  Rat   176 VKIPVQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCWVTGWGKT 240

  Fly   156 QSSGSSSIPSQLQYVNVNIVSQSQC----ASSTYGYGSQIRNTMICA-AASGKDACQGDSGGPLV 215
            ...|.||  ..|:.|:::|:...:|    ...|....:.::...:|. ...|.||||||||||:|
  Rat   241 IERGRSS--RVLREVDLSIIRHERCNQILKDITGRIFTLVQEGGVCGYNKKGGDACQGDSGGPMV 303

  Fly   216 ----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVV 250
                ...|.||:||||.||....|||:|.:|:..|.|::
  Rat   304 CEFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWII 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/231 (35%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 81/231 (35%)
Tryp_SPc 113..341 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.