DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss33

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:271 Identity:94/271 - (34%)
Similarity:135/271 - (49%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVV--CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANII 66
            ::::|.|.:  ||..|.      |::..|||||.......:|||.|:|..|:|.||||:.:...:
  Rat    11 LLVVLGARMQECAACGQ------PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWV 69

  Fly    67 VTAAHCL-QSVSASVLQVRAGS---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            :||.||. :.|..|...|..|:   ...||..::..|........|:.:....|:|:::||..:|
  Rat    70 LTAGHCFSRRVLPSEYSVLLGALSLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQLSHPVS 134

  Fly   128 FSSSIKAISLAT--YNPANGASAAVSGWGTQSSGSSSIP----SQLQYVNVNIVSQSQCASSTYG 186
            .|:.|:.:.|..  .:|..|:...|:|||:.|.|   :|    ..||.|.|.::....| ...|.
  Rat   135 LSARIQPVCLPAPGSHPPPGSPCWVTGWGSLSPG---VPLPKGRPLQGVRVPLLDSRAC-DRLYH 195

  Fly   187 YGSQIRNT-------MICAA--ASGKDACQGDSGGPLV---SG-GVLVGVVSWGYGCAYSNYPGV 238
            .|:.:..:       .:||.  ...||||||||||||.   || .|||||||||.|||..|.|||
  Rat   196 MGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGV 260

  Fly   239 YADVAVLRSWV 249
            |.:||....|:
  Rat   261 YTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 87/241 (36%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 87/241 (36%)
Tryp_SPc 34..272 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.