DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss36

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:251 Identity:81/251 - (32%)
Similarity:126/251 - (50%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTY 89
            |:...||||||.....::|||:||...|.|.||||:.:.:.:::||||.  |:...|:   .:..
  Rat    53 PEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCF--VTNGTLE---PADE 112

  Fly    90 WS------------SGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL--ATY 140
            ||            .|..:..|::....:.|:...:..|:|::||:|......|:|.:.|  |::
  Rat   113 WSVLLGVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASH 177

  Fly   141 NPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQC-----ASSTYGYGSQIRNTMICAA 199
            ..|:|.:...:||| .|.|....:|..||.|.:.::.::.|     ....:....|:...|:||.
  Rat   178 LFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAG 242

  Fly   200 --ASGKDACQGDSGGPLV--SGG--VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
              ...:|.||||||||||  .||  .|.|:.|:|:||...|.|||:..||...||:
  Rat   243 YPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/244 (32%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 79/245 (32%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.