DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC496623

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001011199.1 Gene:LOC496623 / 496623 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:230 Identity:103/230 - (44%)
Similarity:140/230 - (60%) Gaps:13/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS-TYWS 91
            |.:|:||:....:|.|:.:|| .||.|.||||:.:...:|:||||.:   ||: |||.|. ....
 Frog    18 DDKIIGGATCAKNSVPYIVSL-NSGYHFCGGSLINNQWVVSAAHCYK---ASI-QVRLGEHNIAL 77

  Fly    92 SGGVVAKVSSFK--NHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWG 154
            |.|....:||.|  .|.|||:.|:.|||.:|:|||:.|.::::.|::|.:...|.|||..:||||
 Frog    78 SEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAVNAVALPSGCAAAGASCLISGWG 142

  Fly   155 TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVSG 217
            ...|..|:.|..||.:...|::.:||.::   |..:|.|.|||..  ..|||:||||||||:|..
 Frog   143 NTLSSGSNYPDLLQCLYAPILTDAQCNNA---YPGEITNNMICLGFLEGGKDSCQGDSGGPVVCN 204

  Fly   218 GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            |.|.||||||||||..||||||..|....||:.||
 Frog   205 GELQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQST 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 99/223 (44%)
LOC496623NP_001011199.1 Tryp_SPc 21..239 CDD:238113 100/225 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.