DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP010617

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001230715.1 Gene:AgaP_AGAP010617 / 4577720 VectorBaseID:AGAP010617 Length:249 Species:Anopheles gambiae


Alignment Length:201 Identity:64/201 - (31%)
Similarity:98/201 - (48%) Gaps:6/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASV--LQVRAGSTYWS 91
            |||....|..|:.:.:..||:..|.:.||..:.|.:..:|.|..:.|.|.||  |.:..|||..:
Mosquito    16 GRITNSVAVDIAKYTFAQSLRLDGRYRCGAVVISTSHALTGAAAVYSFSNSVQRLTLYGGSTSPT 80

  Fly    92 SGGVVAKVSSFKNHEGYNANTMVND--IAVIRL-SSSLSFSSSIKAISLATYNPANGASAAVSGW 153
            ||||..:|.....|..||.|..|:|  |||:.: :::.....:|..|.||:...:.|...:|.||
Mosquito    81 SGGVSFQVIRIAVHPNYNPNGGVSDFNIAVLTVPTNAFGGKRNIVPIPLASAGVSIGTKCSVFGW 145

  Fly   154 GTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAAS-GKDACQGDSGGPLVSG 217
            |:.:....:..:.|:...:.|.|::.||......|.:|.:.::||... ..|.|.||.|..||..
Mosquito   146 GSTNLNLLAPVNALRAAGMVITSEATCARVWAQLGVKITSNILCAKGDRAADLCNGDLGNGLVCN 210

  Fly   218 GVLVGV 223
            |.|.||
Mosquito   211 GKLTGV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 63/200 (32%)
AgaP_AGAP010617XP_001230715.1 Tryp_SPc 34..217 CDD:304450 59/183 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.