DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP010615

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001237581.1 Gene:AgaP_AGAP010615 / 4577718 VectorBaseID:AGAP010615 Length:272 Species:Anopheles gambiae


Alignment Length:271 Identity:84/271 - (30%)
Similarity:137/271 - (50%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTV---------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGS 59
            |.::|..:.|  |..|         |:|  ....||||.|.|.:|..:.:.:||:.:|...||.:
Mosquito     5 ISLVLFGLFC--GSAVLTDASDQNKPDG--ASQSGRIVNGKAVSIVKYKYALSLRVNGVFECGAT 65

  Fly    60 IYSANIIVTAAHCL--QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN----DIA 118
            |.:....:|||||:  |......:.:..|||...:|||:..|.....|.||:.:...:    |:|
Mosquito    66 IITHKHALTAAHCVYPQRFEPMRVSLYGGSTSAVTGGVLFSVVRIAVHPGYDHSYFPDASEYDVA 130

  Fly   119 VIRLSSSLSFSS--SIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCA 181
            |:.:::: :||.  ::.::.|.|.....|....|:|||...:...:..:||:|..:.||.||.||
Mosquito   131 VLTVANN-AFSGKPNMASLILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLRYAEMTIVDQSTCA 194

  Fly   182 SSTYGYGSQ-IRNTMICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAV 244
            .:...|..| :.:.||||. .:|.|.|:|||||.||.||.|.||||:......|.:|..::.::.
Mosquito   195 RAWATYPRQRVTSNMICAKYGNGVDTCKGDSGGALVCGGGLAGVVSFTNLECTSAWPAGFSKISA 259

  Fly   245 --LRSWVVSTA 253
              :|.::.:.|
Mosquito   260 PSIRRFISTEA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/230 (33%)
AgaP_AGAP010615XP_001237581.1 Tryp_SPc 36..259 CDD:214473 74/223 (33%)
Tryp_SPc 37..258 CDD:238113 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.