DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:263 Identity:91/263 - (34%)
Similarity:137/263 - (52%) Gaps:14/263 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLD----GRIVGGSATTISSFPWQISLQRSG-SHSCGGSI 60
            ||:.|..:.:|:..:.......|:  ||    .|:|||......|.|:|:|||..| .|:||||:
Mosquito     1 MLRKVFAVVSVLLVVSAAKVTKLV--LDDHYVNRVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSL 63

  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSS 125
            .:...::||||||.....|.|.|..|:.....||.:.||.....|..||.....|||.::||...
Mosquito    64 LNNRWVLTAAHCLVGYEPSDLMVLVGTNSLKEGGELLKVDKLLYHSRYNRPQFHNDIGLMRLEQP 128

  Fly   126 LSFSSSIKAIS-LATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189
            :.||..::::. |....|.| |:..::||| ::|.:.::|:.||.:||..:|...| .:..|...
Mosquito   129 VQFSELVQSVEYLEKAVPVN-ATVRLTGWG-RTSTNGNVPTLLQSLNVVTLSNEDC-KAKMGNPE 190

  Fly   190 QIRNTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST- 252
            .:....:|. ..:|:.||.||||||||..|.|||||::|..|. ..:|..:|.|:....||.:| 
Mosquito   191 NVDLGHVCTLTKAGEGACNGDSGGPLVYEGKLVGVVNFGVPCG-RGFPDGFARVSYYHEWVRTTM 254

  Fly   253 ANS 255
            ||:
Mosquito   255 ANN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/221 (36%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 79/221 (36%)
Tryp_SPc 33..253 CDD:238113 80/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.